Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LETM1 Peptide - middle region

LETM1 Peptide - middle region

Product Specifications

UniProt

O95202

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036450.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCF3 (ATP-binding Cassette Sub-family F Member 3, EST201864, FLJ11198) discontinued
151347 100 µg

ABCF3 (ATP-binding Cassette Sub-family F Member 3, EST201864, FLJ11198) discontinued

Sign In for Pricing
View Details
MCM4 Rabbit Polyclonal Antibody (FITC)
orb2131534 100 µL

MCM4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CA122 rabbit pAb
E28PT7690 100 µL

CA122 rabbit pAb

Sign In for Pricing
View Details
DYNC1H1 Antibody
orb20440 100 µg

DYNC1H1 Antibody

Sign In for Pricing
View Details
NFKB p65 Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1593046 100 µL

NFKB p65 Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
Recombinant Rhesus ERBB2 Protein (aa 1-652) [Fc]
VAng-Cr3985-50g 50 µg

Recombinant Rhesus ERBB2 Protein (aa 1-652) [Fc]

Sign In for Pricing
View Details