Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX4 Peptide - middle region

DLX4 Peptide - middle region

Product Specifications

Product Name Alternative

BP1, DLX7, DLX8, DLX9

UniProt

Q92988

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001925.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C4orf52 (SMIM20) activation kit by CRISPRa
GA118037 1 Kit

Human C4orf52 (SMIM20) activation kit by CRISPRa

Sign In for Pricing
View Details
Human VEGFA Recombinant Rabbit monoclonal Antibody
HA723497B 100 µL

Human VEGFA Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
(S)-(-)-2-Amino-3-Benzyloxy-1-Propanol
TRC-A600200-25G 25 g

(S)-(-)-2-Amino-3-Benzyloxy-1-Propanol

Sign In for Pricing
View Details
Sphingomyelin Synthase 2 (SGMS2) Rabbit Polyclonal Antibody
AP05208PU-N 100 µg

Sphingomyelin Synthase 2 (SGMS2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human LRG1 Protein (His Tag)
PKSH033295-01 10 µg

Recombinant Human LRG1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LRG1 Protein (His Tag)
PKSH033295-02 50 µg

Recombinant Human LRG1 Protein (His Tag)

Sign In for Pricing
View Details