Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP10 Peptide - middle region

DUSP10 Peptide - middle region

Product Specifications

Product Name Alternative

MKP5, MKP-5

UniProt

Q9Y6W6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_009138.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endoglin (CD105, ENG, END) (HRP)
126322-HRP 100 µL

Endoglin (CD105, ENG, END) (HRP)

Sign In for Pricing
View Details
Ig Kappa Antibody
orb423557-01 0.5 mg

Ig Kappa Antibody

Sign In for Pricing
View Details
Ig Kappa Antibody
orb423557-02 1 mg

Ig Kappa Antibody

Sign In for Pricing
View Details
PTPN3 Polyclonal Antibody
MBS2521809-01 0.02 mL

PTPN3 Polyclonal Antibody

Sign In for Pricing
View Details
PTPN3 Polyclonal Antibody
MBS2521809-02 0.06 mL

PTPN3 Polyclonal Antibody

Sign In for Pricing
View Details
PTPN3 Polyclonal Antibody
MBS2521809-03 0.12 mL

PTPN3 Polyclonal Antibody

Sign In for Pricing
View Details