What is the catalog number for OSTM1 Peptide - C-terminal region?

The catalog number for OSTM1 Peptide - C-terminal region is orb1998503.

What sizes are available for OSTM1 Peptide - C-terminal region?

OSTM1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is OSTM1 Peptide - C-terminal region in stock?

OSTM1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

OSTM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GL, GIPN, OPTB5, HSPC019

UniProt

Q86WC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_054747.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPVIAVSVFILFLPVVFYLSSFLHSEQKKRKLILPKRLKSSTSFANIQEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P253011 1 mL

Epichlorhydrin [CAS:106-89-8] 1000ug/ml in Methanol

Sign In for Pricing

View Details

E45M53433M2-100 100 µg

FZD1/Frizzled 1 Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing

View Details

TR108A-P > 2x 10^6 Cells

pGreenFire1-LXRE in ApoE(HepG2 cell line)

Sign In for Pricing

View Details

G2013-70-APC 200 µL

GARP (Glycoprotein A Repetitions Predominant, GARP Protein, Garpin, D11S833E, Leucine-rich Repeat-containing Protein 32, LRRC32) (APC) discontinued

Sign In for Pricing

View Details

GTR10404879 96 Well

Goat Anthrax toxin receptor like (ANTXRL) ELISA kit

Sign In for Pricing

View Details

MBS7278794-01 48 Well

Sheep Pituitary Adenylate Cyclase Activating Peptide 38 ELISA Kit

Sign In for Pricing

View Details