Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMOD1 Peptide - middle region

TMOD1 Peptide - middle region

Product Specifications

Product Name Alternative

TMOD, ETMOD, D9S57E

UniProt

P28289

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159588.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLER

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PstI, 2000U
RE1320 2000 U

PstI, 2000U

Sign In for Pricing
View Details
HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), 0.2mg/mL
BNUB2207-100 1x 100 µL

HSP60 (Heat Shock Protein 60) (Mitochondrial Marker) (rGROEL/780), 0.2mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
Human TTR (Transthyretin) ELISA Kit
E-EL-H6192-01 24 Tests

Human TTR (Transthyretin) ELISA Kit

Sign In for Pricing
View Details