Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK10 Peptide - C-terminal region

MAPK10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK

UniProt

P53779

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MYL1 Protein (Sumo Tag)
PDEH101142-01 20 µg

Recombinant Human MYL1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human MYL1 Protein (Sumo Tag)
PDEH101142-02 100 µg

Recombinant Human MYL1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human MYL1 Protein (Sumo Tag)
PDEH101142-03 500 µg

Recombinant Human MYL1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human MYL1 Protein (Sumo Tag)
PDEH101142-04 1 mg

Recombinant Human MYL1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Sphingomyelin (SM) Fluorometric Assay Kit
E-BC-F079 96 T (40 samples)

Sphingomyelin (SM) Fluorometric Assay Kit

Sign In for Pricing
View Details
Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL
BNC942266-100 1x 100 µL

Calcineurin B homologous protein 2 / HCC Antigen 520 (CPTC-CHP2-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details