MAPK10 Peptide - C-terminal region
MAPK10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
UniProt
P53779
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002744.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-GDF5-Mu-01 96 Tests
Mouse Growth Differentiation Factor 5 (GDF5) ELISA Kit
Sign In for Pricing
View Details RDR-GDF5-Mu-02 48 Tests
Mouse Growth Differentiation Factor 5 (GDF5) ELISA Kit
Sign In for Pricing
View Details 
BNC742961-500 1x 500 µL
C1QB / Complement C1q B-Chain (C1QB/2961), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942409-500 1x 500 µL
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 