Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNDP2 Peptide - C-terminal region

CNDP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CN2, CPGL, PEPA, HsT2298, HEL-S-13

UniProt

Q96KP4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001161971.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LINC00588 Human shRNA Plasmid Kit (Locus ID 26138)
TR319784 1 Kit

LINC00588 Human shRNA Plasmid Kit (Locus ID 26138)

Sign In for Pricing
View Details
Recombinant Human hepatitis A virus genotype IA Genome polyprotein, partial
MBS1207515 Inquire

Recombinant Human hepatitis A virus genotype IA Genome polyprotein, partial

Sign In for Pricing
View Details
KCNAB3 Rabbit Polyclonal Antibody
orb258579 100 µg

KCNAB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Klc1 ELISA Kit
ELI-38204r 96 Tests

Rat Klc1 ELISA Kit

Sign In for Pricing
View Details
PPP2R3A Rabbit Polyclonal Antibody (Fluoro488)
orb3095157 100 µg

PPP2R3A Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
rno-miR-511-5p miRNA Inhibitor
MIR01689 2x 5.0 nmol

rno-miR-511-5p miRNA Inhibitor

Sign In for Pricing
View Details