VPS53 Peptide - middle region
VPS53 Peptide - middle region
Product Specifications
Product Name Alternative
HCCS1, PCH2E, hVps53L, pp13624
UniProt
Q5VIR6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001121631.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2092744-01 0.1 mL
Biotin-Linked Polyclonal Antibody to Cytochrome P450 2E1 (CYP2E1)
Sign In for Pricing
View Details MBS2092744-02 0.2 mL
Biotin-Linked Polyclonal Antibody to Cytochrome P450 2E1 (CYP2E1)
Sign In for Pricing
View Details MBS2092744-03 0.5 mL
Biotin-Linked Polyclonal Antibody to Cytochrome P450 2E1 (CYP2E1)
Sign In for Pricing
View Details MBS2092744-04 1 mL
Biotin-Linked Polyclonal Antibody to Cytochrome P450 2E1 (CYP2E1)
Sign In for Pricing
View Details