Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VPS53 Peptide - middle region

VPS53 Peptide - middle region

Product Specifications

Product Name Alternative

HCCS1, PCH2E, hVps53L, pp13624

UniProt

Q5VIR6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001121631.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VYIESQDKNLGELIDRFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxy-3- (3-methylbut-2-en-1-yl) benzoic acid
BAA13841-01 100 mg

4-Hydroxy-3- (3-methylbut-2-en-1-yl) benzoic acid

Sign In for Pricing
View Details
4-Hydroxy-3- (3-methylbut-2-en-1-yl) benzoic acid
BAA13841-02 1 g

4-Hydroxy-3- (3-methylbut-2-en-1-yl) benzoic acid

Sign In for Pricing
View Details
DNAJB6 Rabbit Polyclonal Antibody (BF750)
orb2414849 100 µL

DNAJB6 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
E-cadherin polyclonal rabbit affinity purified
HS-467 003 50 µg

E-cadherin polyclonal rabbit affinity purified

Sign In for Pricing
View Details
HHIP Antibody
OACA09073-50UL 50 µL

HHIP Antibody

Sign In for Pricing
View Details
Rabbit anti-lTGB4/CD104/lntegrin beta-4 Antibody, Affinity Purified
A305-203A-T 10 µg

Rabbit anti-lTGB4/CD104/lntegrin beta-4 Antibody, Affinity Purified

Sign In for Pricing
View Details