What is the catalog number for TACC2 Peptide - C-terminal region?

The catalog number for TACC2 Peptide - C-terminal region is orb1998486.

What sizes are available for TACC2 Peptide - C-terminal region?

TACC2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TACC2 Peptide - C-terminal region in stock?

TACC2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TACC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AZU-1, ECTACC

UniProt

O95359

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D7942 96 Tests

Golgi apparatus protein 1 (GLG1) Rat ELISA Kit

Sign In for Pricing

View Details

NBP3-21123APC 0.1 mL

Mouse Monoclonal MLH1 Antibody (MLH1/7562) [Allophycocyanin]

Sign In for Pricing

View Details

GTR10347286 96 Well

Rabbit CMRF35 like molecule 2 (CD300E) ELISA Kit

Sign In for Pricing

View Details

BP222-500ug 500 µg

Recombinant Cynomolgus ROR1 (C-hFc)

Sign In for Pricing

View Details

PA1874-1-Dylight594 100 µg

Anti-CD163 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing

View Details

W0158-01 20 µL

VEGF-A (PT0865) Antibody

Sign In for Pricing

View Details