Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACC2 Peptide - C-terminal region

TACC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AZU-1, ECTACC

UniProt

O95359

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278807.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PASAMEANGVDGDGLNKPAKKKKTPLKTDTFRVKKSPKRSPLSDPPSQDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HR Assay Kit (Spectrophotometry)
orb3132153 50 Tests

HR Assay Kit (Spectrophotometry)

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His
AP2C614-01 1 mg

Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His
AP2C614-02 10 µg

Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His
AP2C614-03 50 µg

Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His

Sign In for Pricing
View Details
Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His
AP2C614-04 500 µg

Recombinant Mouse Sonic Hedgehog Protein (Shh), C-His

Sign In for Pricing
View Details
Phospho-DAXX (Ser495) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-5291R-BF647-01 20 µL

Phospho-DAXX (Ser495) Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details