Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK11 Peptide - N-terminal region

MAPK11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2

UniProt

Q16539

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002742.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI5H3]
CF807110 100 µg

PAPSS2 Mouse Monoclonal Antibody [Clone ID: OTI5H3]

Sign In for Pricing
View Details
EIF1 (NM_005801) Human Over-expression Lysate
LY401762 100 µg

EIF1 (NM_005801) Human Over-expression Lysate

Sign In for Pricing
View Details
C12orf56 (NM_001099676) Human Over-expression Lysate
LC420488 20 µg

C12orf56 (NM_001099676) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS621069 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Recombinant Mouse CD74 Protein (mFc & His Tag)
PKSM041039-01 10 µg

Recombinant Mouse CD74 Protein (mFc & His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD74 Protein (mFc & His Tag)
PKSM041039-02 50 µg

Recombinant Mouse CD74 Protein (mFc & His Tag)

Sign In for Pricing
View Details