Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK11 Peptide - N-terminal region

MAPK11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2

UniProt

Q16539

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002742.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lestaurtinib
SIH-460-5MG 5 mg

Lestaurtinib

Sign In for Pricing
View Details
NOBOX (NM_001080413) Human Over-expression Lysate
LY421630 100 µg

NOBOX (NM_001080413) Human Over-expression Lysate

Sign In for Pricing
View Details
CD86 (C86/1146), CF647 conjugate, 0.1mg/mL
BNC471146-500 1x 500 µL

CD86 (C86/1146), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FARP2 Rabbit Polyclonal Antibody
TA366322 100 µL

FARP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZDHHC8 (NM_001185024) Human Over-expression Lysate
LC433491 20 µg

ZDHHC8 (NM_001185024) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Carbobenzyloxy-L-aspartic Acid 1-Benzyl Ester
TRC-C176300-2.5G 2.5 g

N-Carbobenzyloxy-L-aspartic Acid 1-Benzyl Ester

Sign In for Pricing
View Details