Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN7 Peptide - middle region

PTPN7 Peptide - middle region

Product Specifications

Product Name Alternative

LPTP, HEPTP, PTPNI, BPTP-4, LC-PTP

UniProt

P35236

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002823.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592) (AP) discontinued
129757-AP 100 µL

MMP26 (Matrix Metalloproteinase-26, MMP-26, Matrilysin-2, Endometase, MGC126590, MGC126592) (AP) discontinued

Sign In for Pricing
View Details
SUV39H2, CT (Histone-lysine N-methyltransferase SUV39H2, Suppressor of Variegation 3-9 Homolog 2, Su (var) 3-9 Homolog 2, Histone H3-K9 Methyltransferase 2, H3-K9-HMTase 2, Lysine N-methyltransferase 1B, KMT1B) (MaxLight 550) discontinued
S8950-02A-ML550 100 µL

SUV39H2, CT (Histone-lysine N-methyltransferase SUV39H2, Suppressor of Variegation 3-9 Homolog 2, Su (var) 3-9 Homolog 2, Histone H3-K9 Methyltransferase 2, H3-K9-HMTase 2, Lysine N-methyltransferase 1B, KMT1B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Phospho-IRAK1 (Thr209) Rabbit Polyclonal Antibody (AP)
orb966893 100 µL

Phospho-IRAK1 (Thr209) Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
CICP13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV721244 1.0 µg DNA

CICP13 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
DNASE1L2 Rabbit Polyclonal Antibody
E10G33559 100 µL

DNASE1L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Breast cancer susceptibility protein 2, BRCA-2 ELISA Kit
YLA1458MO-01 48 Tests

Mouse Breast cancer susceptibility protein 2, BRCA-2 ELISA Kit

Sign In for Pricing
View Details