Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR3 Peptide - N-terminal region

PLSCR3 Peptide - N-terminal region

Product Specifications

UniProt

Q9NRY6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001188505.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gabrr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7089306 1.0 µg DNA

Gabrr3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PHKA1 (NM_001122670) Human Tagged ORF Clone
RC226362 10 µg

PHKA1 (NM_001122670) Human Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal LMAN2 Antibody (02) [Alexa Fluor 647]
NBP3-05830AF647 0.1 mL

Mouse Monoclonal LMAN2 Antibody (02) [Alexa Fluor 647]

Sign In for Pricing
View Details
NECAP1 Antibody Blocking Peptide
orb1508631 500 µg

NECAP1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Human O mg Protein, His Tag
E40KMPH1411 20 µg

Human O mg Protein, His Tag

Sign In for Pricing
View Details
Hdgfrp2 3'UTR Lenti-reporter-Luc Vector
23145086 1.0 µg

Hdgfrp2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details