Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR3 Peptide - N-terminal region

PLSCR3 Peptide - N-terminal region

Product Specifications

UniProt

Q9NRY6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001188505.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APIP Protein Vector (Human) (pPB-His-GST)
PV322739 500 ng

APIP Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Chicken Infectious mononucleosis IgG ELISA
GTR10477130 96 Well

Chicken Infectious mononucleosis IgG ELISA

Sign In for Pricing
View Details
MS4A4A Antibody
E314983 100 µg - 200 µL

MS4A4A Antibody

Sign In for Pricing
View Details
NPL Rabbit Polyclonal Antibody (FITC)
orb2093961 100 µL

NPL Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ANXA1 | ANX1 Rabbit pAb, BF700 conjugated
orb3124315 100 µL

ANXA1 | ANX1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Dlx6 3'UTR Lenti-reporter-Luc Vector
18300084 1.0 µg

Dlx6 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details