RCN2 Peptide - middle region
RCN2 Peptide - middle region
Product Specifications
Product Name Alternative
E6BP, ERC55, ERC-55, TCBP49
UniProt
Q14257
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258766.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEFV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1391039-01 0.02 mg (E-Coli)
Recombinant Pongo abelii SH2 domain-containing protein 5 (SH2D5)
Sign In for Pricing
View Details MBS1391039-02 0.02 mg (Yeast)
Recombinant Pongo abelii SH2 domain-containing protein 5 (SH2D5)
Sign In for Pricing
View Details MBS1391039-03 0.1 mg (E-Coli)
Recombinant Pongo abelii SH2 domain-containing protein 5 (SH2D5)
Sign In for Pricing
View Details MBS1391039-04 0.1 mg (Yeast)
Recombinant Pongo abelii SH2 domain-containing protein 5 (SH2D5)
Sign In for Pricing
View Details MBS1391039-05 0.02 mg (Baculovirus)
Recombinant Pongo abelii SH2 domain-containing protein 5 (SH2D5)
Sign In for Pricing
View Details MBS1391039-06 0.02 mg (Mammalian-Cell)
Recombinant Pongo abelii SH2 domain-containing protein 5 (SH2D5)
Sign In for Pricing
View Details