Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB6 Peptide - middle region

SERPINB6 Peptide - middle region

Product Specifications

Product Name Alternative

CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057

UniProt

P35237

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182220.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LINGO2 activation kit by CRISPRa
GA115941 1 Kit

Human LINGO2 activation kit by CRISPRa

Sign In for Pricing
View Details
Soybean Oil
TRC-S677870-100ML 100 mL

Soybean Oil

Sign In for Pricing
View Details
Human EIF3K activation kit by CRISPRa
GA109128 1 Kit

Human EIF3K activation kit by CRISPRa

Sign In for Pricing
View Details
ADORA1 Antibody
8G201-AAT 50 µg

ADORA1 Antibody

Sign In for Pricing
View Details
Flufenacet ESA Sodium Salt
TRC-F599428-50MG 50 mg

Flufenacet ESA Sodium Salt

Sign In for Pricing
View Details
2,2,2-Trifluoro-N-phenylacetimidoyl Chloride
TRC-T792605-1G 1 g

2,2,2-Trifluoro-N-phenylacetimidoyl Chloride

Sign In for Pricing
View Details