Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB6 Peptide - middle region

SERPINB6 Peptide - middle region

Product Specifications

Product Name Alternative

CAP, PI6, PTI, PI-6, SPI3, DFNB91, MSTP057

UniProt

P35237

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182220.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2310030G06Rik Mouse Gene Knockout Kit (CRISPR)
KN500236 1 Kit

2310030G06Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561441 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: rectosigmoid
CS713592 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
RNF146 Antibody
KC-2019-01 50 μL

RNF146 Antibody

Sign In for Pricing
View Details
RNF146 Antibody
KC-2019-02 100 µL

RNF146 Antibody

Sign In for Pricing
View Details
RNF146 Antibody
KC-2019-03 1 mL

RNF146 Antibody

Sign In for Pricing
View Details