Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMRN1 Peptide - N-terminal region

MMRN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ECM, MMRN, GPIa*, EMILIN4

UniProt

Q13201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031377.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPR75-ASB3 activation kit by CRISPRa
GA119251 1 Kit

Human GPR75-ASB3 activation kit by CRISPRa

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF647 conjugate, 0.1mg/mL
BNC470833-500 1x 500 µL

Calponin-1 (CALP + CNN1/832), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific Antigen (HSA) Mouse Monoclonal Antibody [Clone ID: SPM582]
AM33286PU-S 100 µg

Hepatocyte Specific Antigen (HSA) Mouse Monoclonal Antibody [Clone ID: SPM582]

Sign In for Pricing
View Details
ORC1 (7F6/1), CF647 conjugate, 0.1mg/mL
BNC473067-500 1x 500 µL

ORC1 (7F6/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzyl 4-Fluorophenyl Ketone
TRC-B279785-1G 1 g

Benzyl 4-Fluorophenyl Ketone

Sign In for Pricing
View Details
DPEP1 (NM_004413) Human Over-expression Lysate
LC401402 20 µg

DPEP1 (NM_004413) Human Over-expression Lysate

Sign In for Pricing
View Details