Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMRN1 Peptide - N-terminal region

MMRN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ECM, MMRN, GPIa*, EMILIN4

UniProt

Q13201

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031377.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGLNNSKHSWTIPEDGNSQKTMPSASVPPNKIQSLQILPTTRVMSAEIAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP2 Human Gene Knockout Kit (CRISPR)
KN200456LP 1 Kit

LAMP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD47 (IAP/964 + B6H12.2), Biotin conjugate, 0.1mg/mL
BNCB1029-100 1x 100 µL

CD47 (IAP/964 + B6H12.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trpv3 Mouse Gene Knockout Kit (CRISPR)
KN518310 1 Kit

Trpv3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SIGLEC9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G8]
TA500373BM 100 µL

SIGLEC9 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G8]

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561979 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Mouse Timm10b activation kit by CRISPRa
GA201490 1 Kit

Mouse Timm10b activation kit by CRISPRa

Sign In for Pricing
View Details