Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYT11 Peptide - middle region

SYT11 Peptide - middle region

Product Specifications

Product Name Alternative

SYT12, sytXI

UniProt

Q9BT88

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_689493.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFIHMLKGISIYPETLSNKKKIIKVRRDKDGPGREGGRRNLLVDAAEAGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM114A1 activation kit by CRISPRa
GA114231 1 Kit

Human FAM114A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Pseudomonas aeruginosa serotype 6C (1200/472), CF640R conjugate, 0.1mg/mL
BNC400240-100 1x 100 µL

Pseudomonas aeruginosa serotype 6C (1200/472), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MDH2 Human Knockdown Lysate
LY300240 100 µg

MDH2 Human Knockdown Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS623272 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Nexilin (NEXN) Human Gene Knockout Kit (CRISPR)
KN424445 1 Kit

Nexilin (NEXN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD59 (NM_000611) Human Recombinant Protein
TP318343L 1 mg

CD59 (NM_000611) Human Recombinant Protein

Sign In for Pricing
View Details