Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4C Peptide - middle region

ARL4C Peptide - middle region

Product Specifications

Product Name Alternative

LAK, ARL7

UniProt

P56559

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269360.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPY10 (C-term) Rabbit Polyclonal Antibody
AP54385PU-N 400 µL

TSPY10 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
iNOS (NOS2) Mouse Monoclonal Antibody [Clone ID: OTI11H3]
TA813520 100 µL

iNOS (NOS2) Mouse Monoclonal Antibody [Clone ID: OTI11H3]

Sign In for Pricing
View Details
7-Amino-1,5-dihydro-5-imino-2,8-quinolinedione Hydrochloride
TRC-A604840-10MG 10 mg

7-Amino-1,5-dihydro-5-imino-2,8-quinolinedione Hydrochloride

Sign In for Pricing
View Details
LCE1B Human Gene Knockout Kit (CRISPR)
KN416290 1 Kit

LCE1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TYRO3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]
TA500417BM 100 µL

TYRO3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]

Sign In for Pricing
View Details
Pentraxin 3 (PTX3) Human Gene Knockout Kit (CRISPR)
KN207922LP 1 Kit

Pentraxin 3 (PTX3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details