Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL4C Peptide - middle region

ARL4C Peptide - middle region

Product Specifications

Product Name Alternative

LAK, ARL7

UniProt

P56559

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001269360.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SIRP alpha (SIRPA) activation kit by CRISPRa
GA115428 1 Kit

Human SIRP alpha (SIRPA) activation kit by CRISPRa

Sign In for Pricing
View Details
Copper Strip Corrosion Tester BPTL-211
BPTL-211 1 Unit

Copper Strip Corrosion Tester BPTL-211

Sign In for Pricing
View Details
LRRC10 Human Gene Knockout Kit (CRISPR)
KN212671LP 1 Kit

LRRC10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215H-01 20 Tests

PE/Cyanine7 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215H-02 100 Tests

PE/Cyanine7 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD44 Antibody[Hermes-1]
E-AB-F1215H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD44 Antibody[Hermes-1]

Sign In for Pricing
View Details