Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G3 Peptide - C-terminal region

PLA2G3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SPLA2III, sPLA2-III, GIII-SPLA2

UniProt

Q9NZ20

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_056530.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl Tosylate
TRC-E927065-10MG 10 mg

Ethyl Tosylate

Sign In for Pricing
View Details
Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI7B9]
CF806341 100 µg

Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI7B9]

Sign In for Pricing
View Details
Ultrasonic Cleaner BULC-914
BULC-914 1 Unit

Ultrasonic Cleaner BULC-914

Sign In for Pricing
View Details
Natural Convection Oven BONC-5601
BONC-5601 1 Unit

Natural Convection Oven BONC-5601

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Human Knockdown Lysate
LY300473 100 µg

Acetyl CoA synthetase (ACSS2) Human Knockdown Lysate

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), Biotin conjugate, 0.1mg/mL
BNCB0918-500 1x 500 µL

CD44 Standard (HCAM/918), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details