EDEM2 Peptide - N-terminal region
EDEM2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C20orf31, C20orf49, bA4204.1
UniProt
Q9BV94
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001138497.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLGLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K4758503 1.0 µg DNA
Dimt1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
12403121 3x 1.0µg DNA
ARL8A CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details