Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDEM2 Peptide - N-terminal region

EDEM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C20orf31, C20orf49, bA4204.1

UniProt

Q9BV94

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001138497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLGLLCALLPQHHGAPGPDGSAPDPAHYRERVKAMFYHAYDSYLENAFPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAM1 Human Gene Knockout Kit (CRISPR)
KN409761 1 Kit

VCAM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Nepsilon-Acetyl-L-lysine (Standard)
HY-113426R-01 10 mg

Nepsilon-Acetyl-L-lysine (Standard)

Sign In for Pricing
View Details
Nepsilon-Acetyl-L-lysine (Standard)
HY-113426R-02 50 mg

Nepsilon-Acetyl-L-lysine (Standard)

Sign In for Pricing
View Details
Nepsilon-Acetyl-L-lysine (Standard)
HY-113426R-03 100 mg

Nepsilon-Acetyl-L-lysine (Standard)

Sign In for Pricing
View Details
Nepsilon-Acetyl-L-lysine (Standard)
HY-113426R-04 250 mg

Nepsilon-Acetyl-L-lysine (Standard)

Sign In for Pricing
View Details
Nepsilon-Acetyl-L-lysine (Standard)
HY-113426R-05 500 mg

Nepsilon-Acetyl-L-lysine (Standard)

Sign In for Pricing
View Details