Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A3 Peptide - C-terminal region

SLC25A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC, PTP, OK/SW-cl.48

UniProt

Q00325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002626.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tensin 1 (TNS1) Human Gene Knockout Kit (CRISPR)
KN424050 1 Kit

Tensin 1 (TNS1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOB48R (APOBR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A6]
TA807166BM 100 µL

APOB48R (APOBR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A6]

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tylosin D
TRC-T947665-1MG 1 mg

Tylosin D

Sign In for Pricing
View Details
Erlenmeyer Flasks
F4062-B 12 Units/Case

Erlenmeyer Flasks

Sign In for Pricing
View Details
6X GelRed® Prestain Buffer with Orange Tracking Dye
#41010 1x 1 mL

6X GelRed® Prestain Buffer with Orange Tracking Dye

Sign In for Pricing
View Details