Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A3 Peptide - C-terminal region

SLC25A3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PHC, PTP, OK/SW-cl.48

UniProt

Q00325

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002626.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), CF405S conjugate, 0.1mg/mL
BNC040701-100 1x 100 µL

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chst10 Mouse Gene Knockout Kit (CRISPR)
KN503320 1 Kit

Chst10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GCM2 Rabbit Polyclonal Antibody
TA384289 100 µL

GCM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit
RD-CCR4-Hu-01 96 Tests

Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit

Sign In for Pricing
View Details
Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit
RD-CCR4-Hu-02 48 Tests

Human Chemokine C-C-Motif Receptor 4 (CCR4) ELISA Kit

Sign In for Pricing
View Details
Variable Volume 8 Channel Micropipette BPIP-308
BPIP-308 1 Unit

Variable Volume 8 Channel Micropipette BPIP-308

Sign In for Pricing
View Details