Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIP4K2C Peptide - N-terminal region

PIP4K2C Peptide - N-terminal region

Product Specifications

Product Name Alternative

PIP5K2C

UniProt

Q8TBX8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139730.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSINELSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory Receptor 2G6 (OR2G6) Antibody
abx217522-01 50 µg

Olfactory Receptor 2G6 (OR2G6) Antibody

Sign In for Pricing
View Details
Olfactory Receptor 2G6 (OR2G6) Antibody
abx217522-02 100 µg

Olfactory Receptor 2G6 (OR2G6) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tnfrsf19 shRNA (UAS) - Lentiviral mouse Tnfrsf19 shRNA (UAS, GFP) (100)
GTR15184809 1 Vial

Lentiviral mouse Tnfrsf19 shRNA (UAS) - Lentiviral mouse Tnfrsf19 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
LC3B Rabbit pAb
MBS8542020-01 0.1 mL

LC3B Rabbit pAb

Sign In for Pricing
View Details
LC3B Rabbit pAb
MBS8542020-02 0.1 mL (AF405L)

LC3B Rabbit pAb

Sign In for Pricing
View Details
LC3B Rabbit pAb
MBS8542020-03 0.1 mL (AF405S)

LC3B Rabbit pAb

Sign In for Pricing
View Details