What is the catalog number for USP36 Peptide - C-terminal region?

The catalog number for USP36 Peptide - C-terminal region is orb1998461.

What sizes are available for USP36 Peptide - C-terminal region?

USP36 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is USP36 Peptide - C-terminal region in stock?

USP36 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

USP36 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DUB1

UniProt

Q9P275

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079366.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAVSQDAIEDSRQARTETVVDDWDEEFDRGKEKKIKKFKREKRRNFNAFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bs-12245R-Cy5.5 100 µL

DAZL Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing

View Details

NB110-61025UV 0.1 mL

Rat Monoclonal VEGF Antibody (RM0009-2G02) [DyLight 350]

Sign In for Pricing

View Details

AP90740 50 µg

Recombinant Human CD49e/ITGA5 Protein, N-GST

Sign In for Pricing

View Details

GTR15091011 1 Vial

Lentiviral human KCNH7 shRNA (UAS) - Lentiviral human KCNH7 shRNA (UAS, iRFP) (100)

Sign In for Pricing

View Details

TR513964 1 Kit

P3h2 Mouse shRNA Plasmid (Locus ID 210530)

Sign In for Pricing

View Details

MBS8316830-01 10 nmol

hsa-miR-2682-5p miRNA Antagomir

Sign In for Pricing

View Details