Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP36 Peptide - C-terminal region

USP36 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DUB1

UniProt

Q9P275

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079366.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAVSQDAIEDSRQARTETVVDDWDEEFDRGKEKKIKKFKREKRRNFNAFQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Granulocyte-Macrophage Colony Stimulating Factor Antibody (GM-CSF Ab) ELISA Kit
EIA05734m 1 Kit

Mouse Granulocyte-Macrophage Colony Stimulating Factor Antibody (GM-CSF Ab) ELISA Kit

Sign In for Pricing
View Details
C6orf114 Over-expression Lysate Product
GWB-F48B01 0.1 mg

C6orf114 Over-expression Lysate Product

Sign In for Pricing
View Details
BRN3A/POU4F1 Rabbit Polyclonal Antibody (FITC)
orb2610833 100 µg

BRN3A/POU4F1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Jarid2 Rabbit Polyclonal Antibody (Biotin)
orb2130659 100 µL

Jarid2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human Activin RIIB/ACVR2B Protein
RP00153-01 10 μg

Recombinant Human Activin RIIB/ACVR2B Protein

Sign In for Pricing
View Details
Recombinant Human Activin RIIB/ACVR2B Protein
RP00153-02 20 μg

Recombinant Human Activin RIIB/ACVR2B Protein

Sign In for Pricing
View Details