Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA2 Peptide - C-terminal region

PDIA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDI, PDA2, PDIP, PDIR

UniProt

Q13087

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006840.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGPGRKVIEYKSTRDLETFSKFLDNGGVLPTEEPPEEPAAPFPEPPANST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FH Antibody
KC-6325-01 50 μL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-6325-02 100 µL

FH Antibody

Sign In for Pricing
View Details
FH Antibody
KC-6325-03 1 mL

FH Antibody

Sign In for Pricing
View Details
HP1 alpha (CBX5) (NM_001127322) Human Over-expression Lysate
LC426745 20 µg

HP1 alpha (CBX5) (NM_001127322) Human Over-expression Lysate

Sign In for Pricing
View Details
Isobornyl Acetate
TRC-I780073-500MG 500 mg

Isobornyl Acetate

Sign In for Pricing
View Details
MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF594 conjugate, 0.1mg/mL
BNC942971-100 1x 100 µL

MRP3 (Multidrug Resistance-Associated Protein 3) (ABCC3/2971), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details