Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYW1 Peptide - C-terminal region

TYW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TYW1A, RSAFD1, YPL207W

UniProt

Q6NUM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060734.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNKSKAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OPN3 Antibody Picoband® Fluoro594 Conjugated
A09353-3-Fluoro594 100 µg/Vial

Anti-OPN3 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
ADA Antibody (C-term)
E45G01544G-4 50 µL

ADA Antibody (C-term)

Sign In for Pricing
View Details
Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
MBS8820392-01 48 Well

Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
MBS8820392-02 96 Well

Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
MBS8820392-03 5x 96 Well

Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details
Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit
MBS8820392-04 10x 96 Well

Cattle NGAL (Neutrophil Gelatinase Associated Lipocalin) ELISA Kit

Sign In for Pricing
View Details