Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TYW1 Peptide - C-terminal region

TYW1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TYW1A, RSAFD1, YPL207W

UniProt

Q6NUM6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060734.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRHQRKNKSKAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Endothelial cell-specific molecule 1 Protein
ARP4830-01 10 µg

Recombinant Mouse Endothelial cell-specific molecule 1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Endothelial cell-specific molecule 1 Protein
ARP4830-02 50 µg

Recombinant Mouse Endothelial cell-specific molecule 1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Endothelial cell-specific molecule 1 Protein
ARP4830-03 100 µg

Recombinant Mouse Endothelial cell-specific molecule 1 Protein

Sign In for Pricing
View Details
Recombinant Mouse Endothelial cell-specific molecule 1 Protein
ARP4830-04 1 mg

Recombinant Mouse Endothelial cell-specific molecule 1 Protein

Sign In for Pricing
View Details
GNRPX Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2382361 100 µL

GNRPX Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Camel Ciliary Neurotrophic Factor ELISA Kit
MBS095099-01 48 Well

Camel Ciliary Neurotrophic Factor ELISA Kit

Sign In for Pricing
View Details