Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPN3 Peptide - middle region

GPN3 Peptide - middle region

Product Specifications

Product Name Alternative

ATPBD1C

UniProt

Q9UHW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157844.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (AP)
MBS6383190-01 0.1 mL

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (AP)

Sign In for Pricing
View Details
ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (AP)
MBS6383190-02 5x 0.1 mL

ITFG2 (Integrin-alpha FG-GAP Repeat-containing Protein 2, MDS028) (AP)

Sign In for Pricing
View Details
Goat Hepcidin (Hepc) ELISA Kit
EIA06620Go 1 Kit

Goat Hepcidin (Hepc) ELISA Kit

Sign In for Pricing
View Details
Phospho-rat PARP1 (S373) Antibody
orb1930954-01 50 µL

Phospho-rat PARP1 (S373) Antibody

Sign In for Pricing
View Details
Phospho-rat PARP1 (S373) Antibody
orb1930954-02 100 µL

Phospho-rat PARP1 (S373) Antibody

Sign In for Pricing
View Details
Dicarbonyl/L-Xylulose Reductase Human Recombinant, Bioactive
rAP-1761 1 Each

Dicarbonyl/L-Xylulose Reductase Human Recombinant, Bioactive

Sign In for Pricing
View Details