Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPN3 Peptide - middle region

GPN3 Peptide - middle region

Product Specifications

Product Name Alternative

ATPBD1C

UniProt

Q9UHW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157844.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSDLRSKKFKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Propargylamino-dCTP-XX-Cy5
orb611226 5 x 10 ul

5-Propargylamino-dCTP-XX-Cy5

Sign In for Pricing
View Details
VDAC1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-52251R-BF647 100 µL

VDAC1 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
Cytochrome P450 19A1, Control Peptide (CYP19A1, ARO1, Aromatase, CPV1, CYAR, CYPXIX, EC 1.14.14.1, MGC104309, P-450AROM, cytochrome P450, family 19, Subfamily A, Polypeptide 1, ARO, AromataseN: Cytochrome P450, Family 19, Cytochrome P450, Subfamily XIX (aromatization of androgens), estrogen synthetase, flavoprotein-linked monooxygenase, microsomal monooxygenase)
147673 100 µg

Cytochrome P450 19A1, Control Peptide (CYP19A1, ARO1, Aromatase, CPV1, CYAR, CYPXIX, EC 1.14.14.1, MGC104309, P-450AROM, cytochrome P450, family 19, Subfamily A, Polypeptide 1, ARO, AromataseN: Cytochrome P450, Family 19, Cytochrome P450, Subfamily XIX (aromatization of androgens), estrogen synthetase, flavoprotein-linked monooxygenase, microsomal monooxygenase)

Sign In for Pricing
View Details
CTBP2 Polyclonal Antibody
E916826 100 µL

CTBP2 Polyclonal Antibody

Sign In for Pricing
View Details
At3g20270 Antibody
orb796529 2 mg

At3g20270 Antibody

Sign In for Pricing
View Details
RAX2 Rabbit Polyclonal Antibody (Biotin)
orb2599665 100 µg

RAX2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details