COQ3 Peptide - middle region
COQ3 Peptide - middle region
Product Specifications
Product Name Alternative
DHHBMT, bA9819.1, DHHBMTASE, UG0215E05
UniProt
Q9NZJ6
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_059117.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YALGIVFSEQIASIVPKGTHTWEKFVSPETLESILESNGLSVQTVVGMLY
More Discoveries
Explore Other Products
Browse additional items from our catalog
QP6732-ec-200ug 200ug
Recombinant Human Sjoegren syndrome nuclear autoantigen 1 Protein, GST, E.coli-200ug
Sign In for Pricing
View Details MBS2804985-01 48 Tests
Human Putative alpha-1-antitrypsin-related protein (SERPINA2) ELISA Kit
Sign In for Pricing
View Details 
MBS2804985-02 96 Tests
Human Putative alpha-1-antitrypsin-related protein (SERPINA2) ELISA Kit
Sign In for Pricing
View Details 
MBS2804985-03 5x 96 Tests
Human Putative alpha-1-antitrypsin-related protein (SERPINA2) ELISA Kit
Sign In for Pricing
View Details