Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAM2 Peptide - C-terminal region

TRAM2 Peptide - C-terminal region

Product Specifications

UniProt

Q15035

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036420.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP1 Mouse Monoclonal Antibody [Clone ID: OTI6C7]
CF808733 100 µg

IGFBP1 Mouse Monoclonal Antibody [Clone ID: OTI6C7]

Sign In for Pricing
View Details
Kallikrein 11 (KLK11) (NM_001136032) Human Over-expression Lysate
LY427779 100 µg

Kallikrein 11 (KLK11) (NM_001136032) Human Over-expression Lysate

Sign In for Pricing
View Details
STAT4 pTyr693 Rabbit Polyclonal Antibody
AP02346PU-N 100 µL

STAT4 pTyr693 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit
RD-MGA-Hu-01 96 Tests

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit

Sign In for Pricing
View Details
Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit
RD-MGA-Hu-02 48 Tests

Human Maltase Glucoamylase, Intestinal (MGA) ELISA Kit

Sign In for Pricing
View Details
ZNHIT3 Rabbit Polyclonal Antibody
TA372002 100 µL

ZNHIT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details