Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABLIM3 Peptide - middle region

ABLIM3 Peptide - middle region

Product Specifications

Product Name Alternative

HMFN1661

UniProt

O94929

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287944.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053) (MaxLight 490)
MBS6202292-01 0.1 mL

PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053) (MaxLight 490)

Sign In for Pricing
View Details
PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053) (MaxLight 490)
MBS6202292-02 5x 0.1 mL

PANK2 (Pantothenate Kinase 2, Mitochondrial, hPanK2, Pantothenic Acid Kinase 2, C20orf48, FLJ11729, FLJ17232, MGC15053) (MaxLight 490)

Sign In for Pricing
View Details
TMEM132E Antibody
orb861496 2 mg

TMEM132E Antibody

Sign In for Pricing
View Details
Tropantiol HCl
orb2815087-01 50 mg

Tropantiol HCl

Sign In for Pricing
View Details
Tropantiol HCl
orb2815087-02 10 mg

Tropantiol HCl

Sign In for Pricing
View Details
Rat Collectin-12 (COLEC12) ELISA Kit
MBS7236175-01 48 Well

Rat Collectin-12 (COLEC12) ELISA Kit

Sign In for Pricing
View Details