Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABLIM3 Peptide - middle region

ABLIM3 Peptide - middle region

Product Specifications

Product Name Alternative

HMFN1661

UniProt

O94929

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001287944.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTYSRQGMSPTFSRSPHHYYRSGPESGRSSPYHSQLDVRSSTPTSYQAPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif-3.C Antibody
orb799947 2 mg

Eif-3.C Antibody

Sign In for Pricing
View Details
FAT4 Rabbit Polyclonal Antibody (Cy3)
orb985991 100 µL

FAT4 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-ALKBH5 Antibody
MBS1753079-01 0.01 mg

Anti-ALKBH5 Antibody

Sign In for Pricing
View Details
Anti-ALKBH5 Antibody
MBS1753079-02 0.1 mg (Carrier Free)

Anti-ALKBH5 Antibody

Sign In for Pricing
View Details
Anti-ALKBH5 Antibody
MBS1753079-03 0.1 mg

Anti-ALKBH5 Antibody

Sign In for Pricing
View Details
Anti-ALKBH5 Antibody
MBS1753079-04 0.1 mg (Cy3)

Anti-ALKBH5 Antibody

Sign In for Pricing
View Details