Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GAT3 Peptide - middle region

B3GAT3 Peptide - middle region

Product Specifications

Product Name Alternative

GLCATI, glcUAT-I

UniProt

O94766

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275652.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD83 antigen (CD83) ELISA kit
CSB-EL004962HU-01 24 Well

Human CD83 antigen (CD83) ELISA kit

Sign In for Pricing
View Details
Human CD83 antigen (CD83) ELISA kit
CSB-EL004962HU-02 96 Well

Human CD83 antigen (CD83) ELISA kit

Sign In for Pricing
View Details
Human CD83 antigen (CD83) ELISA kit
CSB-EL004962HU-03 5x 96 Well

Human CD83 antigen (CD83) ELISA kit

Sign In for Pricing
View Details
Human CD83 antigen (CD83) ELISA kit
CSB-EL004962HU-04 10x 96 Well

Human CD83 antigen (CD83) ELISA kit

Sign In for Pricing
View Details
RNASE11 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
40194064 1.0 µg DNA

RNASE11 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant human IL-13R alpha 2/IL13RA2 protein
ATGP2139-500 500 µg

Recombinant human IL-13R alpha 2/IL13RA2 protein

Sign In for Pricing
View Details