Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP17 Peptide - middle region

ARHGAP17 Peptide - middle region

Product Specifications

Product Name Alternative

PP367, RICH1, WBP15, MST066, MST110, NADRIN, PP4534, RICH-1, MSTP038, MSTP066, MSTP110

UniProt

Q68EM7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001006635.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVSEAFVPLTTPSSNHSFHTGNDSDSGTLERKRPASMAVMEGDLVKKESF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF405S conjugate, 0.1mg/mL
BNC043438-100 1x 100 µL

CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QIL1 (C19orf70) Human Gene Knockout Kit (CRISPR)
KN402349 1 Kit

QIL1 (C19orf70) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Occludin (OCLN) activation kit by CRISPRa
GA119306 1 Kit

Human Occludin (OCLN) activation kit by CRISPRa

Sign In for Pricing
View Details
UBTD1 Rabbit Polyclonal Antibody
AP54448PU-N 400 µL

UBTD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 4C2]
AM12139RP-N 100 Tests

Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: 4C2]

Sign In for Pricing
View Details
TIPIN (NM_017858) Human Over-expression Lysate
LY402647 100 µg

TIPIN (NM_017858) Human Over-expression Lysate

Sign In for Pricing
View Details