Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGAP17 Peptide - middle region

ARHGAP17 Peptide - middle region

Product Specifications

Product Name Alternative

PP367, RICH1, WBP15, MST066, MST110, NADRIN, PP4534, RICH-1, MSTP038, MSTP066, MSTP110

UniProt

Q68EM7

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001006635.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NVSEAFVPLTTPSSNHSFHTGNDSDSGTLERKRPASMAVMEGDLVKKESF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5-Diisopropylphenol
TRC-D455295-250MG 250 mg

3,5-Diisopropylphenol

Sign In for Pricing
View Details
FKBP2 (NM_057092) Human Over-expression Lysate
LY403297 100 µg

FKBP2 (NM_057092) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C19orf63 (EMC10) activation kit by CRISPRa
GA117133 1 Kit

Human C19orf63 (EMC10) activation kit by CRISPRa

Sign In for Pricing
View Details
SPON1 Antibody
KC-7823-01 50 μL

SPON1 Antibody

Sign In for Pricing
View Details
SPON1 Antibody
KC-7823-02 100 µL

SPON1 Antibody

Sign In for Pricing
View Details
SPON1 Antibody
KC-7823-03 1 mL

SPON1 Antibody

Sign In for Pricing
View Details