Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDHA2 Peptide - middle region

PDHA2 Peptide - middle region

Product Specifications

Product Name Alternative

PDHAL

UniProt

P08559

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005381.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DC Current Meter EDM-80
1091480/22 1 Each

DC Current Meter EDM-80

Sign In for Pricing
View Details
Human C1qC (Complement Component 1, Q Subcomponent C) ELISA Kit
EK243072 96 Well

Human C1qC (Complement Component 1, Q Subcomponent C) ELISA Kit

Sign In for Pricing
View Details
Olfr317 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4139803 1.0 µg DNA

Olfr317 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Anti-TEAD1 Rabbit mAb
CMA6424-01 30 µL

Recombinant Anti-TEAD1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-TEAD1 Rabbit mAb
CMA6424-02 50 μL

Recombinant Anti-TEAD1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-TEAD1 Rabbit mAb
CMA6424-03 100 µL

Recombinant Anti-TEAD1 Rabbit mAb

Sign In for Pricing
View Details