Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDHA2 Peptide - middle region

PDHA2 Peptide - middle region

Product Specifications

Product Name Alternative

PDHAL

UniProt

P08559

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005381.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MELQTYRYHGHSMSDPGVSYRTREEIQEVRSKRDPIIILQDRMVNSKLAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr378 ORF Vector (Mouse) (pORF)
33111014 1.0 µg DNA

Olfr378 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Leucokinin I
E-PP-1449-01 10 mg

Leucokinin I

Sign In for Pricing
View Details
Leucokinin I
E-PP-1449-02 100 mg

Leucokinin I

Sign In for Pricing
View Details
Leucokinin I
E-PP-1449-03 5 mg

Leucokinin I

Sign In for Pricing
View Details
Rabbit anti-APOBEC3G Antibody
YLD0504-01 50 µL

Rabbit anti-APOBEC3G Antibody

Sign In for Pricing
View Details
Rabbit anti-APOBEC3G Antibody
YLD0504-02 100 µL

Rabbit anti-APOBEC3G Antibody

Sign In for Pricing
View Details