What is the catalog number for ADAP2 Peptide - middle region?

The catalog number for ADAP2 Peptide - middle region is orb1998445.

What sizes are available for ADAP2 Peptide - middle region?

ADAP2 Peptide - middle region is available in the following size(s): 100 µg.

Is ADAP2 Peptide - middle region in stock?

ADAP2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ADAP2 Peptide - middle region

Product Specifications

Product Name Alternative

CENTA2, cent-b, HSA272195

UniProt

Q9NPF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISIKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP1-04351F 0.1 mL

Mouse Monoclonal UbcH8/Ube2L6 Antibody (k1H3) [FITC]

Sign In for Pricing

View Details

abx271662-01 200 µL

Osteopontin (SPP1) Antibody (Biotin)

Sign In for Pricing

View Details

abx271662-02 1 mL

Osteopontin (SPP1) Antibody (Biotin)

Sign In for Pricing

View Details

LV710164 1.0 µg DNA

FHL3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing

View Details

MBS5318312-01 10 g

Equine Serum Albumin

Sign In for Pricing

View Details

MBS5318312-02 5x 10 g

Equine Serum Albumin

Sign In for Pricing

View Details