What is the catalog number for ADAP2 Peptide - middle region?

The catalog number for ADAP2 Peptide - middle region is orb1998445.

What sizes are available for ADAP2 Peptide - middle region?

ADAP2 Peptide - middle region is available in the following size(s): 100 µg.

Is ADAP2 Peptide - middle region in stock?

ADAP2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ADAP2 Peptide - middle region

Product Specifications

Product Name Alternative

CENTA2, cent-b, HSA272195

UniProt

Q9NPF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISIKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS2552804-01 0.01 mg

Recombinant Human Importin Subunit Beta-1/KPNB1 Protein (N-6His)

Sign In for Pricing

View Details

MBS2552804-02 0.05 mg

Recombinant Human Importin Subunit Beta-1/KPNB1 Protein (N-6His)

Sign In for Pricing

View Details

MBS2552804-03 5x 0.05 mg

Recombinant Human Importin Subunit Beta-1/KPNB1 Protein (N-6His)

Sign In for Pricing

View Details

E45M18751V-2 50 µL

ZNF217 Mouse Monoclonal Antibody [Clone 1D9]

Sign In for Pricing

View Details

MBS288712-01 48 Well

Rat Plasma protease C1 inhibitor ELISA Kit

Sign In for Pricing

View Details

MBS288712-02 96 Well

Rat Plasma protease C1 inhibitor ELISA Kit

Sign In for Pricing

View Details