Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAP2 Peptide - middle region

ADAP2 Peptide - middle region

Product Specifications

Product Name Alternative

CENTA2, cent-b, HSA272195

UniProt

Q9NPF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]
E-AB-F1029UM-02 100 µg

Elab Fluor® 647 Anti-Mouse CD122/IL-2RB Antibody[5H4]

Sign In for Pricing
View Details
Amodiaquine-d10
TRC-A634202-1MG 1 mg

Amodiaquine-d10

Sign In for Pricing
View Details
CD71 (TFRC) Mouse Monoclonal Antibody [Clone ID: B-G24]
AM31239FC-N 1 mL (100 Tests)

CD71 (TFRC) Mouse Monoclonal Antibody [Clone ID: B-G24]

Sign In for Pricing
View Details
SMG5 Rabbit Polyclonal Antibody
HA500236 100 µL

SMG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant S100A1 Monoclonal Antibody
AN301707L-01 50 µL

Recombinant S100A1 Monoclonal Antibody

Sign In for Pricing
View Details