Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAP2 Peptide - middle region

ADAP2 Peptide - middle region

Product Specifications

Product Name Alternative

CENTA2, cent-b, HSA272195

UniProt

Q9NPF8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10/13 (DE-K13), CF647 conjugate, 0.1mg/mL
BNC470696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Fluoro-AB-PINACA
TRC-F489490-5MG 5 mg

5-Fluoro-AB-PINACA

Sign In for Pricing
View Details
DNA polymerase mu (POLM) (NM_001284330) Human Tagged ORF Clone
RG238626 10 µg

DNA polymerase mu (POLM) (NM_001284330) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant HDHD5 Antibody
RC-4807-01 50 μL

Recombinant HDHD5 Antibody

Sign In for Pricing
View Details
Recombinant HDHD5 Antibody
RC-4807-02 100 µL

Recombinant HDHD5 Antibody

Sign In for Pricing
View Details
Recombinant HDHD5 Antibody
RC-4807-03 1 mL

Recombinant HDHD5 Antibody

Sign In for Pricing
View Details